If you have been reading about melanocortin receptors and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-03-02. Where a claim depends on a specific study, the study is described rather than over-claimed.
Because the substance circulates mainly through informal markets, verification is a recurring theme in technical discussion. Independent analyses have found that labeled content and actual content can diverge, and that purity varies between samples. Analytical laboratories use reversed-phase chromatography to separate components and mass spectrometry to confirm identity. Isotope-labeled internal standards improve quantification in complex matrices. Such methods describe what a sample contains but say nothing about its sterility, lawful status, or suitability for any use. Open questions remain about how consistently testing is applied across the supply chain.
Regulatory treatment of this peptide varies by country. It holds no marketing authorization as a medicine in the United States, the European Union, or most other jurisdictions. Some countries classify products containing it as prescription-only or unlicensed medicines, which restricts lawful supply. Authorities have issued public notices warning that unregulated products may contain undeclared or incorrect ingredients. The molecule also appears on prohibited lists for competitive sport. These measures address supply oversight rather than any approved therapeutic role.
Regulatory treatment varies between countries. Several national medicines agencies have classified the peptide as unapproved, and customs authorities in some jurisdictions seize shipments on that basis. A few jurisdictions channel supply through prescription-only frameworks that do not list the substance by name. Because the material circulates mainly through online vendors, composition and purity are rarely verified before sale. Surveys of unapproved peptide products have reported labels that did not match measured content in a substantial fraction of samples.
Melanotan II is a synthetic cyclic heptapeptide analogue of alpha-melanocyte-stimulating hormone, a naturally occurring peptide involved in pigmentation signalling. Its structure substitutes a lactam bridge between side chains to increase stability relative to the native hormone. The compound is also known by the shorthand MT-II and by several non-proprietary synonyms used in research catalogues. It is not an approved therapeutic product in any major jurisdiction; material sold under this name is typically offered as a laboratory reagent rather than as a medicine.
Activity is attributed to agonism at melanocortin receptors, particularly MC1R and MC4R. Activation of MC1R on melanocytes increases melanin synthesis, which underlies the reported tanning effect. MC4R engagement in the central nervous system is linked to appetite suppression and to effects on sexual arousal reported in early clinical studies. Those studies were small and were not designed to establish efficacy or long-term safety. Receptor selectivity among the melanocortin subtypes is not absolute, which complicates attribution of any effect to a single pathway.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Not approved as a medicine | No marketing authorization in major jurisdictions |
| Scheduling example | Prescription-only supply in some countries | Handled as an unlicensed medicine where restricted |
| Sports classification | Prohibited peptide | Appears on anti-doping prohibited lists |
| Reported presentation | Lyophilized vial | Nominal content varies between vendors |
| Detection approach | Liquid chromatography–tandem mass spectrometry | Used in anti-doping and forensic testing |
Independent verification is central to quality control because the compound is not produced under pharmaceutical manufacturing standards. Third-party laboratories can measure purity, identity, residual solvents, and microbial contamination, though the scope of testing varies between services. Reported analyses of vendor samples have shown batch-to-batch variation in peptide content and the presence of truncated or oxidized species. How much of this variation reflects synthesis conditions versus storage and shipping is not well characterized. No harmonized reference standard exists for the material as sold.
Handling guidance for melanotan II follows general practice for small synthetic peptides rather than a product-specific monograph. Lyophilized powder is typically kept at minus twenty degrees Celsius or colder, protected from light and moisture, because warmth and humidity accelerate degradation. Once reconstituted, solutions are usually refrigerated and used within a short window, as hydrolysis and microbial growth both become concerns. Repeated freeze-thaw cycles are generally avoided. These conventions come from laboratory peptide chemistry and not from formal stability studies on this specific compound.
Analytical confirmation of identity relies on mass spectrometry, most often coupled to liquid chromatography. Reversed-phase high-performance liquid chromatography separates the peptide from related impurities and provides a purity estimate based on peak area. Electrospray ionization mass spectrometry then confirms the expected molecular mass, while tandem mass spectrometry can map the fragment sequence. For research-grade material, these two techniques together form the standard minimum. Purity figures reported by vendors are frequently not traceable to an independent laboratory.
Research interest has centred on photoprotection and pigmentation, with a smaller body of work on appetite and sexual function. Published human data remain limited to small, frequently uncontrolled studies, and the compound has never received marketing approval from a national medicines regulator. Most laboratory work treats it as a pharmacological tool for probing melanocortin signalling in cell culture or animal models. Whether pigmentation changes observed in people translate into measurable protection against ultraviolet-induced DNA damage remains an open question.
Melanotan-2 is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone, the naturally occurring peptide involved in pigmentation signalling. Its sequence is conventionally written as Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, with a lactam bridge joining the aspartate side chain to the lysine side chain. The empirical formula is C50H69N15O9 and the monoisotopic mass lies near 1023.5 daltons. N-terminal acetylation and the D-configured phenylalanine both increase resistance to enzymatic breakdown compared with the parent hormone.
Pharmacologically, melanotan-2 behaves as a non-selective agonist across the melanocortin receptor family. Binding at MC1R on dermal melanocytes promotes eumelanin synthesis, which underlies the tanning response described in early human work. Activity at the centrally expressed MC4R receptor is associated with reported effects on appetite and erectile function. Because the peptide does not discriminate strongly among receptor subtypes, attributing any single observed effect to one receptor pathway is generally not possible without selective antagonists or receptor knockout models.
Regulatory status differs by country, and in many places supplying the compound for human consumption is unlawful. Vendors frequently label material as intended for research use only, a designation that shifts stated purpose but does not create a legal pathway for personal use. Certificates of analysis accompanying such products vary widely in detail and provenance. Third-party testing exists but is voluntary, and results are rarely linked to a specific lot in a publicly verifiable way.
Identity testing for a synthetic peptide relies on several complementary methods. Reversed-phase high-performance liquid chromatography separates the target from related impurities and reports purity as a percentage of total peak area. Mass spectrometry confirms molecular mass and can reveal deletions or truncations. Amino acid analysis and peptide mapping provide sequence-level confirmation, while counter-ion content and residual solvents are measured separately. A purity figure alone does not establish identity, so a complete dataset combines chromatographic and spectrometric evidence.
Lyophilized peptide powder is generally stored frozen, protected from light and moisture. Tryptophan residues are susceptible to oxidation, and the lactam bridge can hydrolyze under strongly acidic or basic conditions. Solutions prepared for laboratory work degrade faster than dry powder, and repeated freeze-thaw cycles accelerate loss. Common practice is to aliquot solutions before freezing and to avoid alkaline buffers. Reported stability windows vary with concentration, buffer, and temperature, so exact shelf lives are method-specific rather than universal.
ties: "I am very disappointed to hear this news. The truth is that continuing to escalate the quality of arms available to an irresponsible regime that has sent terrorists to India, and in the name of anti-terrorism, is cynicism of the highest order". The Indian Government summoned the US Ambassador to India to convey its disapproval regarding the sale of F-16 fighter jets to Pakistan.
=== Purine catabolism === Purine degradation primarily occurs in the liver in humans and requires a series of enzymes to break down purines into uric acid. First, nucleotides lose their phosphate groups through the action of 5'-nucleotidase. The purine nucleoside adenosine is then deaminated by adenosine deaminase and hydrolyzed by a nucleosidase to form hypoxanthine. Hypoxanthine is subsequently oxidized to xanthine and then to uric acid via the enzyme xanthine oxidase. The other purine nucleoside, guanosine, is cleaved to form guanine. Guanine is then deaminated by guanine deaminase to produce xanthine, which is further converted to uric acid. In both degradation pathways, oxygen serves as the final electron acceptor. The excretion of uric acid varies among different animals. Free purine and pyrimidine bases released within the cell are often transported across membranes and salvaged through the nucleotide salvage pathway to regenerate nucleotides. For example, adenine combines with phosphoribosyl pyrophosphate (PRPP) to form adenosine monophosphate (AMP) and pyrophosphate (PPi) in a reaction catalyzed by adenine phosphoribosyltransferase. Similarly, free guanine is salvaged via a reaction requiring hypoxanthine-guanine phosphoribosyltransferase (HGPRT). Defects in purine catabolism can lead to various diseases, including gout, which results from the accumulation of uric acid crystals in joints, and adenosine deaminase deficiency, which causes immunodeficiency.
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
== Reception == The review aggregator website Rotten Tomatoes reports a 95% approval rating with an average rating of 7.80/10 based on 20 reviews. The website's consensus reads, "Increased pressure on a key couple brings heightened stakes and more exciting twists to Scandal's action-packed, consistently gripping fifth season.
=== Medicine === Nitrogen heterocycles in general, and pyridines in particular, are widely used structural motifs in pharmaceuticals. In a study published in 2021, the structures of all pharmaceuticals approved by the Food and Drug Administration in the United States were analyzed with respect to nitrogen heterocycles. Sixty-two of these compounds contained a pyridine unit, making pyridines the second most common nitrogen heterocycles after piperidines. Most pyridine rings were mono- or disubstituted, with substituents in the 2-position occurring most frequently. Pyridine-containing pharmaceuticals include a number of structurally very similar antihistamines, such as chlorphenamine and brompheniramine. Proton pump inhibitors such as pantoprazole contain a pyridine ring as an important structural element. These active substances are prodrugs that, in addition to the pyridine ring, contain a sulfoxide and a benzimidazole unit. The actual active species is a cyclic sulfenamide. To generate this species, the benzimidazole moiety must be activated by protonation, whereas the pyridine must be deprotonated so that it can act as a nucleophile. Consequently, substituents that modulate the PKs values of the nitrogen atoms or enhance the nucleophilicity of the pyridine nitrogen are of crucial importance. In addition to pantoprazole, this class of drugs includes omeprazole, lansoprazole, and rabeprazole.
Sources: en.wikipedia.org
=== Nordic countries === Norway was the first country in the world to outlaw beak trimming in 1974, followed by Finland in 1986 and Sweden in 1988. Beak trimming was subsequently phased out in Denmark in two stages: in 2013 for the enriched cage system and in 2014 for aviary and free range systems.
=== IR sources === FTIR spectrometers are mostly used for measurements in the mid and near IR regions. For the mid-IR region, 2−25 μm (5,000–400 cm−1), the most common source is a silicon carbide (SiC) element heated to about 1,200 K (930 °C; 1,700 °F) (Globar). The output is similar to a blackbody. Shorter wavelengths of the near-IR, 1−2.5 μm (10,000–4,000 cm−1), require a higher temperature source, typically a tungsten-halogen lamp. The long wavelength output of these is limited to about 5 μm (2,000 cm−1) by the absorption of the quartz envelope. For the far-IR, especially at wavelengths beyond 50 μm (200 cm−1) a mercury discharge lamp gives higher output than a thermal source.
Antibody diversification typically occurs through somatic hypermutation, class switching, and affinity maturation targeting the BCR gene loci, but on occasion more unconventional forms of diversification have been documented. For example, in the case of malaria caused by Plasmodium falciparum, some antibodies from those who had been infected demonstrated an insertion from chromosome 19 containing a 98-amino acid stretch from leukocyte-associated immunoglobulin-like receptor 1, LAIR1, in the elbow joint. This represents a form of interchromosomal transposition. LAIR1 normally binds collagen, but can recognize repetitive interspersed families of polypeptides (RIFIN) family members that are highly expressed on the surface of P. falciparum-infected red blood cells. In fact, these antibodies underwent affinity maturation that enhanced affinity for RIFIN but abolished affinity for collagen. These "LAIR1-containing" antibodies have been found in 5–10% of donors from Tanzania and Mali, though not in European donors. European donors did show 100–1000 nucleotide stretches inside the elbow joints as well, however. This particular phenomenon may be specific to malaria, as infection is known to induce genomic instability.
In humans, FDC-SP was first found within follicular dendritic cell isolates from the tonsil, and later was found to be specifically expressed within the periodontal ligament. FDC-SP expression can be induced in human FDC-like cell lines by exposure to tumour necrosis factor (TNF). Exposure of human peripheral blood cells to LPS can also result in FDC-SP expression, but TNF exposure does not cause FDC-SP expression and similarly LPS exposure does not cause expression within FDC-like cell lines. Expression in mouse splenocytes can be induced by LPS in a similar manner to that of human peripheral blood cells. In mice, as in humans, FDC-SP is not expressed in B cells, but FDC-SP expression in FDCs can be dependent on B cells after their stimulation by CD40. After stimulation with CD40, B cells have been shown to be able to induce phenotypic changes in FDCs through the B cell's surface TNF expression. It has therefore been suggested that the expression of TNF cytokines by B cells causes FDC-SP expression within FDCs upon contact. This reaction is said to be typical during GC formation. FDC-SP is highly expressed in the junctional epithelium and well as in the tonsils, prostate, lymph nodes and trachea. The proline rich region in the C-terminal half bears some resemblance to the antimicrobial peptide Bac5. FDC-SP may therefore have a role in microbial defense in the oral cavity.
The world annual production of the various species of Chlorella was 2000 tonnes (dry weight) in 2009, with the main producers being Germany, Japan and Taiwan. C. vulgaris is a candidate for commercial production due to its high resistance against adverse conditions and invading organisms. In addition, the production of the various organic macromolecules of interest (proteins, lipids, starch) differ depending on the technique used to create biomass and can be therefore targeted. Under more hostile conditions, the biomass decreases, but lipids and starch contents increase. Under nutrient and light-replete conditions, protein content increases along with the biomass. Different growth techniques have been developed. Different modes of growth (autotrophic, heterotrophic, and mixotrophic) has been investigated for Chlorella vulgaris; autotrophic growth is favoured as it does not require provision of costly organic carbon and relies on inorganic carbon sources (CO2, carbonates) and light for photosynthesis. Chlorella sp. cultivated in digested and membrane-pretreated swine manure is capable of improving the growth medium performance of microalgae cultivations in terms of final biomass productivity, showing that algal growth depends on the turbidity of liquid digestate streams rather than on their nutrient availability.
Sources: en.wikipedia.org
Only a small number of early-stage human studies have been reported, and most were limited in size and duration. No large late-stage program has established a general efficacy or safety profile. The evidence base is therefore thin compared with approved medicines.
The peptide is listed as prohibited in competitive sport, so laboratories develop detection methods and monitor for its presence. Its appearance in enforcement reports reflects that classification rather than any approved athletic use. Analytical work in this area focuses on identifying the molecule and its breakdown products in biological samples.
Chromatographic separation combined with mass spectrometry identifies the peptide and estimates its amount in a sample. Testing can confirm whether the expected molecule is present and at what concentration. It cannot establish how a product was manufactured or whether it meets any purity standard.
No. No major regulatory agency has granted a marketing authorisation for melanotan II as a medicine. Products sold under this name are generally presented as laboratory reagents and are not subject to the batch-release testing applied to approved drugs.