If you have been reading about mass spectrometry and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2025-09-03. Where a claim depends on a specific study, the study is described rather than over-claimed.
Research interest has centred on photoprotection and pigmentation, with a smaller body of work on appetite and sexual function. Published human data remain limited to small, frequently uncontrolled studies, and the compound has never received marketing approval from a national medicines regulator. Most laboratory work treats it as a pharmacological tool for probing melanocortin signalling in cell culture or animal models. Whether pigmentation changes observed in people translate into measurable protection against ultraviolet-induced DNA damage remains an open question.
Melanotan-2 is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone, the naturally occurring peptide involved in pigmentation signalling. Its sequence is conventionally written as Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, with a lactam bridge joining the aspartate side chain to the lysine side chain. The empirical formula is C50H69N15O9 and the monoisotopic mass lies near 1023.5 daltons. N-terminal acetylation and the D-configured phenylalanine both increase resistance to enzymatic breakdown compared with the parent hormone.
Pharmacologically, melanotan-2 behaves as a non-selective agonist across the melanocortin receptor family. Binding at MC1R on dermal melanocytes promotes eumelanin synthesis, which underlies the tanning response described in early human work. Activity at the centrally expressed MC4R receptor is associated with reported effects on appetite and erectile function. Because the peptide does not discriminate strongly among receptor subtypes, attributing any single observed effect to one receptor pathway is generally not possible without selective antagonists or receptor knockout models.
Regulatory status varies by jurisdiction, and the substance is frequently described as unapproved for therapeutic use. Some authorities classify it alongside prescription-only medicines or controlled categories, while others address it through general consumer protection rules. Analytical surveys have reported mismatches between label claims and measured content in products sold online, although the scope of such testing is limited. Whether these discrepancies are widespread remains an open question. Discussion in the literature therefore tends to combine chemistry, supply-chain observation and policy analysis.
The material is commonly handled as a lyophilized powder in sealed vials. The solid dissolves readily in water and in polar organic solvents, producing a clear solution after reconstitution. Light, heat and repeated freeze-thaw cycles are the concerns most often raised in handling guidance, because peptide bonds and the constrained ring can degrade. Working solutions are generally prepared fresh, and material left in solution is treated as less stable than the dry form. These properties shape how laboratories store and aliquot reference material.
| Property | Value | Notes |
|---|---|---|
| Common synonyms | Melanotan II; MT-II; N-acetyl-norleucyl-cyclo[Asp-His-D-Phe-Arg-Trp-Lys] amide | Naming follows peptide convention; the numeral distinguishes it from melanotan-1 |
| Molecular formula | C50H69N15O9 | Includes the lactam bridge; no counter-ion assumed |
| Monoisotopic mass | 1023.53 Da | Free base; salts and counter-ions shift the observed value |
| Appearance | White to off-white lyophilised powder | Batch-to-batch colour variation is not itself proof of impurity |
| Typical analytical method | RP-HPLC purity determination with ESI-MS identity confirmation | Retention time alone does not establish sequence identity |
Receptor binding at MC1R on melanocytes raises intracellular cyclic AMP and increases expression of tyrosinase and related enzymes. The downstream result is greater synthesis of eumelanin, the dark pigment, without ultraviolet exposure acting as the trigger. The compound is not selective, however, and also engages MC3R, MC4R and MC5R, which are expressed in the central nervous system and elsewhere. That lack of selectivity is the explanation usually offered for effects reported outside pigmentation, including appetite suppression and nausea. Selectivity remains a central theme in comparative studies of related peptides.
Human data remain limited and mostly short-term. Reports describe small trials and observational accounts rather than large controlled studies, so questions about dose-response relationships and long-term effects on melanocytes stay open. Whether repeated exposure alters naevus behaviour is not settled in the published record. Researchers also note that self-administered use outside clinical settings makes actual exposure difficult to quantify. Statements about efficacy and safety should therefore be read as preliminary rather than established.
Melanotan II is a synthetic cyclic heptapeptide that acts as an agonist at melanocortin receptors. It was designed as a structural analogue of alpha-melanocyte-stimulating hormone, the endogenous peptide involved in pigment production. The analogue carries a lactam bridge that constrains the ring and slows enzymatic breakdown relative to the native hormone. In research literature it appears under several abbreviations, and naming conventions are not fully standardized. Published descriptions usually place it within the broader melanocortin agonist family.
Regulatory treatment varies by country. In the United States the peptide is not approved as a medicine, and products offered for human use may be treated as unapproved new drugs; some states also restrict sale. Australia, the United Kingdom, and European Union member states apply comparable restrictions to unapproved peptide products. Border agencies have seized shipments labelled as research chemicals. Classification may change over time, and the legal position for personal importation is not clearly settled in most published guidance.
Lyophilised melanotan-2 is supplied as a solid, which is more stable than a solution. The material is hygroscopic, so weighing is done quickly, in low humidity, with the container kept sealed. Reconstitution usually uses water for injection or bacteriostatic water, added down the wall of the vial to limit foaming. A reconstituted solution is held at 2 to 8 °C and kept away from light. Repeated freezing and thawing of the same vial is avoided because ice crystal formation and concentration effects degrade the peptide.
peptide-C(O)NHCH2CO2− + O2 + 2 [H] → peptide-C(O)NHCH(OH)CO2− + H2O This process shown above is the hydroxylation of a methylene group (-CH2-) by O2, and this process relies on a copper ion cofactor. Dopamine beta-hydroxylase, also a copper-containing enzyme, effects a similar transformation. The PAL subunit then completes the conversion, by catalyzing elimination from the hydroxylated glycine:
=== Anti-gp210 and anti-p62 === Both anti-glycoprotein-210 (anti-gp210) and anti-nucleoporin 62 (anti-p62) antibodies are antibodies to components of the nuclear membrane and are found in primary biliary cirrhosis (PBC). Each antibody is present in approximately 25–30% of PBC. The antigens of both antibodies are constituents of the nuclear membrane. gp210 is a 200kDa protein involved in anchoring components of the nuclear pore to the nuclear membrane. The p62 antigen is a 60kDa nuclear pore complex.
=== Lymph production === Because the pores in the hepatic sinusoids are very permeable and allow ready passage of both fluid and proteins into the perisinusoidal space, the lymph draining from the liver usually has a protein concentration of about 6 g/dl, which is only slightly less than the protein concentration of plasma. Also, the high permeability of the liver sinusoid epithelium allows large quantities of lymph to form. Therefore, about half of all the lymph formed in the body under resting conditions arises in the liver.
The glycemic (glycaemic) index (GI; ) is a number from 0 to 100 assigned to a food, with pure glucose arbitrarily given the value of 100, which represents the relative rise in the blood glucose level two hours after consuming that food. The GI of a specific food depends primarily on the type of carbohydrate it contains, but is also affected by the amount of entrapment of the carbohydrate molecules within the food, the fat, protein content of the food, the moisture and fiber content, the amount of organic acids (or their salts) (e.g., citric or acetic acid), and the method of cooking. GI tables, which list many types of foods and their GIs, are available. A food is considered to have a low GI if it is 55 or less; high GI if 70 or more; and mid-range GI if 56 to 69. The term was introduced in 1981 by David J. Jenkins and co-workers and was created to compare the relative effects of different foods on postprandial glucose levels. It is useful for quantifying the relative rapidity with which the body breaks down carbohydrates. It takes into account only the available carbohydrate (total carbohydrate minus fiber) in a food. Glycemic index does not predict an individual's glycemic response to a food, but can be used as a tool to assess the insulin response burden of a food, averaged across a studied population. Individual responses vary greatly. The glycemic index is usually applied in the context of the quantity of the food and the amount of carbohydrate in the food that is actually consumed.
Asquith had offered the Six Counties (later to become Northern Ireland) an opt out from Home Rule for six years (i.e., until after two more general elections were likely to have taken place) but the Nationalists refused to agree to permanent Partition of Ireland. Historian George Dangerfield has argued that the multiplicity of crises in 1910 to 1914, political and industrial, so weakened the Liberal coalition before the war broke out that it marked the Strange Death of Liberal England. Political scientist Harold Webb Jr. also concludes that the combination of overambitious reforms, internal divisions and external political pressures set the stage for the Party's post-World War I fragmentation and decline. However, most historians date the collapse to the crisis of the First World War.
Sources: en.wikipedia.org
the exact colour of the spore powder (white/cream/ochre), the taste (mild/bitter/acrid), colour changes in the flesh, the distance from the centre to which the cap skin can be pulled off: (peeling percentage). cap colour (but this is often very variable within one species), reaction of the flesh to ferrous sulphate (FeSO4), formalin, alkalis, and other chemicals, ornamentation of the spores, and other microscopic characteristics, such as the appearance of the cystidia in various mounting reagents. Despite the difficulty in positively identifying collected specimens, the possibility to spot the toxic species by their acrid taste makes some of the mild species, such as R. cyanoxantha and R. vesca, popular edible mushrooms. Russula is mostly free of deadly poisonous species, and mild-tasting ones are all edible.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Acral persistent papular mucinosis Atypical lichen myxedematosus (intermediate lichen myxedematosus) Atypical tuberous myxedema (Jadassohn–Dosseker syndrome) Cutaneous focal mucinosis Cutaneous lupus mucinosis (papular and nodular mucinosis in lupus erythematosus, papular and nodular mucinosis of Gold, papulonodular mucinosis in lupus erythematosus) Discrete papular lichen myxedematosus Eccrine mucinosis Follicular mucinosis (alopecia mucinosa, mucinosis follicularis, Pinkus' follicular mucinosis, Pinkus' follicular mucinosis–benign primary form) Localized lichen myxedematosus Myxoid cyst (digital mucous cyst, mucous cyst) Myxoid lipoblastoma Neuropathia mucinosa cutanea Nodular lichen myxedematosus Papular mucinosis (generalized lichen myxedematosus, sclerodermoid lichen myxedematosus, scleromyxedema) Papular mucinosis of infancy (cutaneous mucinosis of infancy) Perifollicular mucinosis Reticular erythematous mucinosis (midline mucinosis, plaque-like cutaneous mucinosis, REM syndrome) Scleroderma Self-healing juvenile cutaneous mucinosis Self-healing papular mucinosis Stiff skin syndrome (congenital fascial dystrophy)
==== Long-term ==== There is consistent evidence of structural and functional deficits in MDMA users with high lifetime exposure. These structural or functional changes appear to be dose dependent and may be less prominent in MDMA users with a lifetime exposure of less than 50 doses used and less than 100 tablets consumed. Nonetheless, moderate MDMA use may still result in neurotoxicity and what constitutes moderate use is not clearly established. Furthermore, it is not clear yet whether "typical" recreational users of MDMA (1 to 2 pills of 75 to 125 mg MDMA or analogue every 1 to 4 weeks) will develop neurotoxic brain lesions. Long-term exposure to MDMA in humans has been shown to produce marked neurodegeneration in striatal, hippocampal, prefrontal, and occipital serotonergic axon terminals. Neurotoxic damage to serotonergic axon terminals has been shown to persist for more than two years. Elevations in brain temperature from MDMA use are positively correlated with MDMA-induced neurotoxicity. However, most studies on MDMA and serotonergic neurotoxicity in humans focus more on heavy users who consume as much as seven times or more the amount that most users report taking. The evidence for the presence of serotonergic neurotoxicity in casual users who take lower doses less frequently is not conclusive. However, adverse neuroplastic changes to brain microvasculature and white matter have been observed to occur in humans using low doses of MDMA. Reduced gray matter density in certain brain structures has also been noted in human MDMA users.
Sources: en.wikipedia.org
It is a synthetic cyclic heptapeptide analogue of alpha-melanocyte-stimulating hormone, containing seven amino acids with a lactam ring and a D-configured phenylalanine residue. It is supplied as a lyophilised powder for laboratory research.
The natural hormone is a linear tridecapeptide that is rapidly degraded in circulation. Melanotan-2 is shortened, cyclised, N-terminally acetylated, and carries a D-amino acid substitution, all of which slow enzymatic breakdown.
No national medicines regulator has approved melanotan-2 for therapeutic or cosmetic use. In several jurisdictions it is treated as an unapproved prescription medicine, and its legal classification differs from country to country.
The dry powder is more stable during transport and storage than a solution. It also allows a known amount of material to be reconstituted at a chosen concentration.